PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013588447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 271aa    MW: 30538.1 Da    PI: 8.6773
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013588447.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W+ ++r  g+ R+ k+c++rw +yl
   XP_013588447.1 14 KGPWTPEEDIILVSYIQQHGPGSWRCVPRNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding513.4e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ Ed+ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   XP_013588447.1  67 RGNFTEHEDKTIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.278961IPR017930Myb domain
SuperFamilySSF466891.87E-3011108IPR009057Homeodomain-like
SMARTSM007172.3E-121363IPR001005SANT/Myb domain
PfamPF002498.3E-151461IPR001005SANT/Myb domain
CDDcd001675.75E-101661No hitNo description
PROSITE profilePS5129424.28262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2565116IPR009057Homeodomain-like
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002498.6E-1567112IPR001005SANT/Myb domain
CDDcd001673.25E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRQPCCEKM EVKKGPWTPE EDIILVSYIQ QHGPGSWRCV PRNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEDKTIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNLQR  120
QNGNSNDDDT NMTEMSSCDN NNNTNRRSVN KGQWEKKLQT DINMAKQALF QALSLDQASS  180
SITPDPDSPK PHDHHSTTAI YASSTDNISK LLQNWTSSSS LMPNTSSLSN NRSSSTGEGG  240
VLDHQCSLFS PNSESGSVDE RLVVFNRAMV I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27111161105MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-271111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756530.0KM975653.1 Brassica napus MYB transcription factor 31.1 (MYB31.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588447.10.0PREDICTED: myb-related protein 306-like isoform X2
SwissprotP813924e-97MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D3CWM80.0A0A0D3CWM8_BRAOL; Uncharacterized protein
STRINGBra003793.1-P1e-160(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.11e-123myb domain protein 31